PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00383.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 345aa    MW: 37466.2 Da    PI: 8.0993
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00383.1_g00026.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.8e-17652147
                             TSSS-HHHHHHHHH.HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvd.avkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEde+l + +v+++G+++W++I++ ++ gR++k+c++rw + 
  Rsa1.0_00383.1_g00026.1  6 KGPWSQEEDEQLRRmVVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 52
                             79**********9835799**************.***********985 PP

2Myb_DNA-binding513.3e-1659103147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r +++ eEde ++ a +++G++ W+tIar ++ gRt++ +k++w++ 
  Rsa1.0_00383.1_g00026.1  59 RRPFSSEEDETILSARAKFGNK-WATIARLLN-GRTDNAVKNHWNST 103
                              679*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.115157IPR017930Myb domain
SuperFamilySSF466899.36E-293100IPR009057Homeodomain-like
SMARTSM007174.0E-14555IPR001005SANT/Myb domain
PfamPF002491.0E-16652IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-24760IPR009057Homeodomain-like
CDDcd001674.23E-15851No hitNo description
SMARTSM007175.2E-1458106IPR001005SANT/Myb domain
PfamPF002492.0E-1359103IPR001005SANT/Myb domain
PROSITE profilePS5129418.16459108IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2261108IPR009057Homeodomain-like
CDDcd001674.83E-1061104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MADRVKGPWS QEEDEQLRRM VVEKYGPRNW SAISKSIPGR SGKSCRLRWC NQLSPEVERR  60
PFSSEEDETI LSARAKFGNK WATIARLLNG RTDNAVKNHW NSTLKRKFVA GGGGGGGGDC  120
DHVAKRRSVS SESSPPVDTE LYLISPESPT STIPSPPSPM PVSGGFTVVP SEEEDPATSL  180
SLSLSLPGAD DGKGSRNTGS SSNNALLFQR FESQMRIDSV EAAGRDEFMR VVQEMIKAEV  240
RSYMSEIQKD SGGFAVGGGG GGLYGTGKGG FRDSGLLPKG CMLVEARWLF GGFAVFISFA  300
GLLKESLLNR FAYPSDMIFT DLDPDCSRYV PKGFAFYPLK ITCSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-4051073104C-Myb DNA-Binding Domain
1msf_C9e-4051073104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013707494.11e-129PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-88MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A078GEJ41e-129A0A078GEJ4_BRANA; BnaC07g31640D protein
STRINGBra012910.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135981527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-84myb domain protein 77